1.67 Rating by ClearWebStats
greendotinfo.com is 1 decade 3 years 5 months old. This website has a #10,844,590 rank in global traffic. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, greendotinfo.com is SAFE to browse.
Get Custom Widget

Traffic Report of Greendotinfo

Daily Unique Visitors: 44
Daily Pageviews: 88

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: 3

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: 10,844,590
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View greendotinfo.com site advisor rating Not Applicable

Where is greendotinfo.com server located?

Hosted IP Address:

173.237.137.16 View other site hosted with greendotinfo.com

Hosted Country:

greendotinfo.com hosted country US greendotinfo.com hosted country

Location Latitude:

30.3423

Location Longitude:

-97.6673

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View greendotinfo.com HTML resources

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 5
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 2
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 173.237.137.16)

Add website, add your company, free listing

greendotinfo.com favicon - alplist.com

View greendotinfo.com Pagerank   greendotinfo.com alexa rank 16,662   greendotinfo.com website value $ 498,960.00



No Nonsense Fat Melting System Review - Does It Work? PDF Download!

greendotinfo.com favicon - nononsensefatmeltingsystemreviews.com

Don’t buy Ted Tanner's No Nonsense Fat Melting System before Reading this Review! Find out if this product really works, and if its the right for you.

View greendotinfo.com Pagerank   greendotinfo.com alexa rank Not Applicable   greendotinfo.com website value $ 8.95

Finetest Functional ATE and Power Supply Testers

greendotinfo.com favicon - finetest2.com

Power Supply Testers, Functional ATE, Military and Aerospace Systems, Functional ATE Systems, Power Supply Test Systems, Hi-Pot Test Systems, ESS Monitoring Systems, Burnin Monitoring Systems, Vibration Monitoring Systems, Manual Test Systems, Test Fixtures and ITAs, Box Builds and Sub-Assemblies, Switching Cards, IO Cards, Custom Cabinets, Custom Cabinet Accessories, Fixtures, Test Programs, UPS Testers, Burn-In, Hipot, Military Power...

View greendotinfo.com Pagerank   greendotinfo.com alexa rank Not Applicable   greendotinfo.com website value $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 11 Jun 2014 19:59:05 GMT
Server: Apache
X-Pingback: http://www.greendotinfo.com/xmlrpc.php
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information for greendotinfo.com

Domain Registrar: GODADDY.COM, LLC greendotinfo.com registrar info
Registration Date: 2010-10-26 1 decade 3 years 5 months ago
Last Modified: 2013-08-11 1 decade 8 months 1 week ago
Expiration Date: 2014-10-26 9 years 5 months 3 weeks ago

Domain Nameserver Information

Host IP Address Country
ns1.speedydns.net greendotinfo.com name server information 162.214.130.229 greendotinfo.com server is located in United States United States
ns2.speedydns.net greendotinfo.com name server information 162.214.129.84 greendotinfo.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
greendotinfo.com A 86397 IP:173.237.137.16
greendotinfo.com NS 86400 Target:ns1.speedydns.net
greendotinfo.com NS 86400 Target:ns2.speedydns.net
greendotinfo.com SOA 86400 MNAME:ns1.speedydns.net
RNAME:none.none.com
Serial:2013110800
Refresh:86400
Retry:7200
Expire:3600000
greendotinfo.com MX 86400 Target:greendotinfo.com
greendotinfo.com TXT 86400 TXT:v=spf1 ip4:65.99.237.24 +a +mx
+ip4:74.86.183.196 ?all

Similarly Ranked Websites to Greendotinfo

the5starhome.com

greendotinfo.com favicon - the5starhome.com

View greendotinfo.com Pagerank   Alexa rank for greendotinfo.com 10,844,611   website value of greendotinfo.com $ 8.95

nontonfilmbioskop.club - Registered at Namecheap.com

greendotinfo.com favicon - nontonfilmbioskop.club

View greendotinfo.com Pagerank   Alexa rank for greendotinfo.com 10,844,632   website value of greendotinfo.com $ 8.95

nontonfilmgratis.club - Registered at Namecheap.com

greendotinfo.com favicon - nontonfilmgratis.club

View greendotinfo.com Pagerank   Alexa rank for greendotinfo.com 10,844,633   website value of greendotinfo.com $ 8.95

assisted-living-41890.com

greendotinfo.com favicon - assisted-living-41890.com

View greendotinfo.com Pagerank   Alexa rank for greendotinfo.com 10,844,652   website value of greendotinfo.com $ 8.95

watch-movie-online.info

greendotinfo.com favicon - watch-movie-online.info

View greendotinfo.com Pagerank   Alexa rank for greendotinfo.com 10,844,657   website value of greendotinfo.com $ 8.95